PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00006g00174.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 301aa    MW: 33685.3 Da    PI: 8.643
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00006g00174.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.38.6e-343488155
                   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                              kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Peaxi162Scf00006g00174.1 34 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 88
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3473191IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-323189IPR009057Homeodomain-like
SuperFamilySSF466891.22E-163389IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-243489IPR006447Myb domain, plants
PfamPF002498.6E-83686IPR001005SANT/Myb domain
PfamPF143792.6E-22130169IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MFHPKKPSSM NSHETHRPMC VQGDSGLVLT TDPKPRLRWT VELHERFVDA VTQLGGPDKA  60
TPKTIMRVMG VKGLTLYHLK SHLQKFRLGK QPHKEFNDHS VKDGDRATNL ELQRNSASSS  120
GMIGRNMNEM QMEVQRRLHE QLEVQRHLQL RIEAQGKYMQ TILEKACQTL GGEENMALPS  180
RTFKGIGNLQ AGGIIPDISA AFKEFGTPPL SFSSFQDLNI CGGHDQQLEL HPQSSMGERS  240
SSFDGFMLGG CNPELDSVSD IYESKPMLDE KKFDAKLERP SPRRAPQISS LSAQVGRNSS  300
F
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6869240.0JQ686924.1 Nicotiana tabacum cultivar SR1 myb family transcription factor APL (APL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006344926.10.0PREDICTED: myb family transcription factor APL isoform X2
SwissprotQ9SAK51e-112APL_ARATH; Myb family transcription factor APL
TrEMBLK4DD700.0K4DD70_SOLLC; Uncharacterized protein
STRINGSolyc12g017370.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA79422231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-114G2-like family protein